PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa015982
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family ZF-HD
Protein Properties Length: 299aa    MW: 33782.1 Da    PI: 6.795
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58682262PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1001.6e-3169124359
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                   vrY+eClkNhAas+Gg+a+DGCgEfm+s geegt +al+Ca C CHRnFHR+e+e 
    Lsa015982  69 VVRYRECLKNHAASIGGKATDGCGEFMAS-GEEGTLEALTCAVCSCHRNFHRKEMEG 124
                  68**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-2170125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.6E-2970122IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.5E-2971122IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.50572121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.6E-28208282IPR009057Homeodomain-like
SuperFamilySSF466891.36E-17216282IPR009057Homeodomain-like
TIGRFAMsTIGR015658.0E-28221278IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MEFHHEHDEE EEEEEEEVGE MALPINTTYG HNHILPLSLH QPPPDMSTIT APPPPPPSME  60
DISKKMMVVV RYRECLKNHA ASIGGKATDG CGEFMASGEE GTLEALTCAV CSCHRNFHRK  120
EMEGDNPSYH RHHHPIPTTS YDYINYHSSS PHLKRLDLGN GRNLILQAHH HHPNGVLGNG  180
GGALVPYNMG MGMGMGMGGF RSESEEQEDR RGAAVAQQVV KKRFRTKFTQ EQKEKMMNFA  240
EKVGWKIQRQ EESVVQHFCQ EIGIKRRVLK VWMHNNKQNL AKNITNSISI NAPQPQDPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A2e-222202771673ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007023152.16e-83Homeobox protein 31
SwissprotO647226e-74ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLA0A103XD341e-111A0A103XD34_CYNCS; Uncharacterized protein
STRINGVIT_12s0035g01880.t013e-80(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.16e-68homeobox protein 21